PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009798550.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 371aa    MW: 41872.2 Da    PI: 9.5253
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009798550.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1248.2e-082442901763
                     HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1  17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                     A+rsR RK+++i eLe+ v++L+ae ++   ele l++++  l +e+
  XP_009798550.1 244 AQRSRVRKLQYISELERTVQALQAEGSEVSAELEFLNQQSLILSMEN 290
                     89************************************998888777 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.1E-4233292IPR004827Basic-leucine zipper domain
CDDcd147031.01E-15235282No hitNo description
Gene3DG3DSA:1.20.5.1704.6E-5244282No hitNo description
SuperFamilySSF579598.13E-6244286No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MANSKGASSM RNMVYNGKSS LLPPKSPFPS ISPSYVDYVP SSAVTQKGIS KSRDGSHHQR  60
TSSESCLIEE QPFWLDDLLN EPETPVRRGG HRRSSSDSFT YHAAANIAHL DYIAQDDNKF  120
RNLTPVPSWG SQDFDYYKDA RHATFHVDQN FSNRQKNRAR DASPNAIQHH RGRPPFRENV  180
KTHSLGASCP PQEGERPKSA GSDKQDLVES VPPNPVGSGE KKDSSHSKSS ASESDTKRAK  240
QQFAQRSRVR KLQYISELER TVQALQAEGS EVSAELEFLN QQSLILSMEN KALKQRLENL  300
AQEQLIKYLE HEVLEKERGR LRALYQQQQL PQSQQQQQSS SSHRRTTSRD LDQQLADLSL  360
KHKDGSGQLH M
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754490.0HG975449.1 Solanum pennellii chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009798548.10.0PREDICTED: uncharacterized protein At4g06598-like
RefseqXP_009798549.10.0PREDICTED: uncharacterized protein At4g06598-like
RefseqXP_009798550.10.0PREDICTED: uncharacterized protein At4g06598-like
RefseqXP_009798551.10.0PREDICTED: uncharacterized protein At4g06598-like
TrEMBLA0A0V0I7S10.0A0A0V0I7S1_SOLCH; Putative basic-leucine zipper transcription factor family protein-like
STRINGPGSC0003DMT4000641691e-170(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58110.21e-81bZIP family protein